PDB entry 3qnm

View 3qnm on RCSB PDB site
Description: Haloalkane Dehalogenase Family Member from Bacteroides thetaiotaomicron of Unknown Function
Class: Structural genomics, unknown function
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Unknown function
Deposited on 2011-02-08, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.168
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A5G8 (3-231)
      • expression tag (2)
      • expression tag (232)
    Domains in SCOPe 2.07: d3qnma1, d3qnma2, d3qnma3
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qnmA (A:)
    mslkyknlffdlddtiwafsrnardtfeevyqkysfdryfdsfdhyytlyqrrntelwle
    ygegkvtkeelnrqrffyplqavgvedealaerfsedffaiiptksglmphakevleyla
    pqynlyilsngfrelqsrkmrsagvdryfkkiilsedlgvlkprpeifhfalsatqselr
    eslmigdsweaditgahgvgmhqafynvtertvfpfqptyhihslkelmnlleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qnmA (A:)
    lkyknlffdlddtiwafsrnardtfeevyqkysfdryfdsfdhyytlyqrrntelwleyg
    egkvtkeelnrqrffyplqavgvedealaerfsedffaiiptksglmphakevleylapq
    ynlyilsngfrelqsrkmrsagvdryfkkiilsedlgvlkprpeifhfalsatqselres
    lmigdsweaditgahgvgmhqafynvtertvfpfqptyhihslkelmnlle