PDB entry 3qnl

View 3qnl on RCSB PDB site
Description: Crystal structure of PrTX-I complexed to Rosmarinic Acid
Class: hydrolase
Keywords: Hydrolase
Deposited on 2011-02-08, released 2012-02-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.161
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog 1
    Species: Bothrops pirajai [TaxId:113192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qnla_
  • Chain 'B':
    Compound: Phospholipase A2 homolog 1
    Species: Bothrops pirajai [TaxId:113192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qnlb_
  • Heterogens: IPA, ROA, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3qnlA (A:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynklyryhlkpfckkadd
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3qnlB (B:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynklyryhlkpfckkadd
c