PDB entry 3qnf

View 3qnf on RCSB PDB site
Description: Crystal structure of the open state of human endoplasmic reticulum aminopeptidase 1 ERAP1
Class: hydrolase
Keywords: Structural Genomics Consortium, SGC, glycoprotein, metal-binding, metalloprotease, protease, adaptive immunity, HYDROLASE
Deposited on 2011-02-08, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP1, APPILS, ARTS1, KIAA0525, UNQ584/PRO1154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qnfa1, d3qnfa2, d3qnfa3
  • Chain 'B':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP1, APPILS, ARTS1, KIAA0525, UNQ584/PRO1154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qnfb1, d3qnfb2, d3qnfb3, d3qnfb4
  • Chain 'C':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP1, APPILS, ARTS1, KIAA0525, UNQ584/PRO1154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qnfc1, d3qnfc2, d3qnfc3, d3qnfc4
  • Heterogens: ZN, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qnfA (A:)
    lrrrytmvflplkwslatmsfllssllalltvstpswcqsteaspkrsdgtpfpwnkirl
    peyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisratlrkgager
    lseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrtkegel
    rilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvaeglied
    hfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtllefye
    dyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitmtvahe
    lahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdamevdaln
    sshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqylqkhsykntk
    nedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqegvdvktmmntwtlqkgfplit
    itvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvlilpee
    vewikfnvgmngyyivhyeddgwdsltgllkgthtavssndraslinnafqlvsigklsi
    ekaldlslylkheteimpvfqglnelipmyklmekrdmnevetqfkaflirllrdlidkq
    twtdegsvsermlrsqllllacvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfav
    gaqstegwdflyskyqfslssteksqiefalcrtqnkeklqwlldesfkgdkiktqefpq
    iltligrnpvgyplawqflrknwnklvqkfelgsssiahmvmgttnqfstrtrleevkgf
    fsslkengsqlrcvqqtietieenigwmdknfdkirvwlqseklermaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qnfA (A:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkglseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrt
    kegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvae
    gliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtl
    lefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitm
    tvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdame
    vdalnsshpvstpvenddvsydkgacilnmlreylsadafksgivqylqkhsykntkned
    lwdsmasivdvktmmntwtlqkgfplititvrgrnvhmkqehymktgylwhvpltfitsk
    sdmvhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavss
    ndraslinnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmn
    evetqfkaflirllrdlidkqtwtdegsvsermlrsqllllacvhnyqpcvqraegyfrk
    wkesqiefalcrtqnieenigwmdknfdkirvwlqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qnfB (B:)
    lrrrytmvflplkwslatmsfllssllalltvstpswcqsteaspkrsdgtpfpwnkirl
    peyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisratlrkgager
    lseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrtkegel
    rilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvaeglied
    hfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtllefye
    dyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitmtvahe
    lahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdamevdaln
    sshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqylqkhsykntk
    nedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqegvdvktmmntwtlqkgfplit
    itvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvlilpee
    vewikfnvgmngyyivhyeddgwdsltgllkgthtavssndraslinnafqlvsigklsi
    ekaldlslylkheteimpvfqglnelipmyklmekrdmnevetqfkaflirllrdlidkq
    twtdegsvsermlrsqllllacvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfav
    gaqstegwdflyskyqfslssteksqiefalcrtqnkeklqwlldesfkgdkiktqefpq
    iltligrnpvgyplawqflrknwnklvqkfelgsssiahmvmgttnqfstrtrleevkgf
    fsslkengsqlrcvqqtietieenigwmdknfdkirvwlqseklermaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qnfB (B:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrklseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrtk
    egelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvaeg
    liedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtll
    efyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitmt
    vahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdamev
    dalnsshpvstpvenpmfddvsydkgacilnmlreylsadafksgivqylqkhsykntkn
    edlwdsmasivdvktmmntwtlqkgfplititvrgrnvhmkqehymtgylwhvpltfits
    ksdmvhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavs
    sndraslinnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdm
    nevetqfkaflirllrdlidkqtwtdegsvsermlrsqllllacvhnyqpcvqraegyfr
    kwkesngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnke
    klqwlldetqefpqiltligrnpvgyplawqflrkahmvmgttnqfstrtrleevqqtie
    tieenigwmdknfdkirvwlqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qnfC (C:)
    lrrrytmvflplkwslatmsfllssllalltvstpswcqsteaspkrsdgtpfpwnkirl
    peyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisratlrkgager
    lseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrtkegel
    rilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvaeglied
    hfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtllefye
    dyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitmtvahe
    lahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdamevdaln
    sshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqylqkhsykntk
    nedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqegvdvktmmntwtlqkgfplit
    itvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvlilpee
    vewikfnvgmngyyivhyeddgwdsltgllkgthtavssndraslinnafqlvsigklsi
    ekaldlslylkheteimpvfqglnelipmyklmekrdmnevetqfkaflirllrdlidkq
    twtdegsvsermlrsqllllacvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfav
    gaqstegwdflyskyqfslssteksqiefalcrtqnkeklqwlldesfkgdkiktqefpq
    iltligrnpvgyplawqflrknwnklvqkfelgsssiahmvmgttnqfstrtrleevkgf
    fsslkengsqlrcvqqtietieenigwmdknfdkirvwlqseklermaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qnfC (C:)
    fpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisrat
    lrkgalseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrt
    kegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvae
    gliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtl
    lefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitm
    tvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdame
    vdalnsshpvstpvenpdvsydkgacilnmlreylsadafksgivqylqkhsykntkned
    lwdsmasivdvktmmntwtlqkgfplititvrgrnvhmkqehymktgylwhvpltfitsk
    sdmvhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavss
    ndraslinnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmn
    evetqfkaflirllrdlidkqtwtdegsvsermlrsqllllacvhnyqpcvqraegyfrk
    wkesngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkek
    lqwllqiltligrnpvgyplawqflrksiahmvmgttnqfstrtrleevkgqqtietiee
    nigwmdknfdkirvwlqsek