PDB entry 3qn2

View 3qn2 on RCSB PDB site
Description: Structure-based design of a disulfide-linked oligomeric form of the Simian Virus 40 (SV40) large T antigen DNA binding domain
Class: hydrolase
Keywords: Origin binding domain, DNA replication, HYDROLASE
Deposited on 2011-02-07, released 2011-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.171
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03070 (2-End)
      • engineered mutation (22)
      • engineered mutation (87)
      • engineered mutation (127)
    Domains in SCOPe 2.05: d3qn2a_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qn2A (A:)
    gskvedpkdfpsellsflshavcsnrtlacfaiyttkekaallykkimekysvtfisrhn
    synhnilffltphrhrvsainnyaqklatfsflickgvnkeylmysaltrdpfsvieesl
    pgglkehcfnpess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qn2A (A:)
    kvedpkdfpsellsflshavcsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
    nhnilffltphrhrvsainnyaqklatfsflickgvnkeylmysaltrdpfsvieeslpg
    glehcf