PDB entry 3qmt

View 3qmt on RCSB PDB site
Description: Crystal structure of the mutant V182A,Y206F of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
Class: lyase/lyase inhibitor
Keywords: tim barrel fold, orotidine 5'-monophosphate decarboxylase, inhibitor BMP, LYASE-LYASE INHIBITOR complex
Deposited on 2011-02-05, released 2012-02-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.165
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
      • engineered mutation (181)
      • engineered mutation (205)
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
      • engineered mutation (181)
      • engineered mutation (205)
    Domains in SCOPe 2.02: d3qmtb_
  • Heterogens: BMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3qmtB (B:)
mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
gagaqggdpgetlrfadaiivgrsifladnpaaaaagiiesikdllnp

    Sequence, based on observed residues (ATOM records): (download) 
    >3qmtB (B:)
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgagaqggd
pgetlrfadaiivgrsifladnpaaaaagiiesikdll