PDB entry 3qmm

View 3qmm on RCSB PDB site
Description: Structure of 6B, a thermostable mutant of Bacillus subtilis lipase obtained through directed evolution
Class: hydrolase
Keywords: lipase, alpha/beta hydrolase, stability, directed evolution, HYDROLASE
Deposited on 2011-02-04, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase estA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: EstA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37957 (Start-180)
      • engineered mutation (14)
      • engineered mutation (16)
      • engineered mutation (19)
      • engineered mutation (88)
      • engineered mutation (110)
      • engineered mutation (113)
      • engineered mutation (131)
      • engineered mutation (133)
      • engineered mutation (136)
      • engineered mutation (156)
      • engineered mutation (162)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d3qmma_
  • Chain 'B':
    Compound: Lipase estA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: EstA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37957 (Start-180)
      • engineered mutation (14)
      • engineered mutation (16)
      • engineered mutation (19)
      • engineered mutation (88)
      • engineered mutation (110)
      • engineered mutation (113)
      • engineered mutation (131)
      • engineered mutation (133)
      • engineered mutation (136)
      • engineered mutation (156)
      • engineered mutation (162)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d3qmmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qmmA (A:)
    aehnpvvmvhgiggsssnfegiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyikyldggnkvanvvtlgganrlttdkappgtdpn
    qkilytsiyssddeivpnylsrldgarnvqihgvghmgllyspqvyslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qmmA (A:)
    hnpvvmvhgiggsssnfegiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyikyldggnkvanvvtlgganrlttdkappgtdpnqk
    ilytsiyssddeivpnylsrldgarnvqihgvghmgllyspqvyslikeglngggqntn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qmmB (B:)
    aehnpvvmvhgiggsssnfegiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvq
    kvldetgakkvdivahsmggantlyyikyldggnkvanvvtlgganrlttdkappgtdpn
    qkilytsiyssddeivpnylsrldgarnvqihgvghmgllyspqvyslikeglngggqnt
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qmmB (B:)
    hnpvvmvhgiggsssnfegiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
    ldetgakkvdivahsmggantlyyikyldggnkvanvvtlgganrlttdkappgtdpnqk
    ilytsiyssddeivpnylsrldgarnvqihgvghmgllyspqvyslikeglngggqntn