PDB entry 3qma

View 3qma on RCSB PDB site
Description: Blackfin tuna myoglobin imidazole complex, atomic resolution
Class: transport protein
Keywords: myoglobin, oxygen storage, heme, iron, TRANSPORT PROTEIN
Deposited on 2011-02-03, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: 0.147
AEROSPACI score: 1.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Thunnus atlanticus [TaxId:48168]
  Database cross-references and differences (RAF-indexed):
  • PDB 3QMA (Start-144)
  Domains in SCOPe 2.07: d3qmaa_
• Heterogens: HEM, IMD, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qmaA (A:)
  adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
  atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
  qtalrnvmgiiiadleanykelgfs