PDB entry 3qma

View 3qma on RCSB PDB site
Description: Blackfin tuna myoglobin imidazole complex, atomic resolution
Class: transport protein
Keywords: myoglobin, oxygen storage, heme, iron, TRANSPORT PROTEIN
Deposited on 2011-02-03, released 2012-02-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: 0.147
AEROSPACI score: 1.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Thunnus atlanticus [TaxId:48168]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QMA (Start-144)
    Domains in SCOPe 2.04: d3qmaa_
  • Heterogens: HEM, IMD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qmaA (A:)
    adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
    atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
    qtalrnvmgiiiadleanykelgfs