PDB entry 3qm3

View 3qm3 on RCSB PDB site
Description: 1.85 Angstrom Resolution Crystal Structure of Fructose-bisphosphate Aldolase (Fba) from Campylobacter jejuni
Class: lyase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TIM beta/alpha-barrel, LYASE
Deposited on 2011-02-03, released 2011-02-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.151
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0597, fba, fda, fdaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAS0 (3-356)
      • expression tag (2)
    Domains in SCOPe 2.01: d3qm3a_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0597, fba, fda, fdaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAS0 (3-356)
      • expression tag (2)
    Domains in SCOPe 2.01: d3qm3b_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0597, fba, fda, fdaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAS0 (3-356)
      • expression tag (2)
    Domains in SCOPe 2.01: d3qm3c_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0597, fba, fda, fdaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAS0 (3-356)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3qm3d_
  • Chain 'E':
    Compound: Fructose-bisphosphate aldolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0597, fba, fda, fdaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAS0 (3-356)
      • expression tag (2)
    Domains in SCOPe 2.01: d3qm3e_
  • Chain 'F':
    Compound: Fructose-bisphosphate aldolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0597, fba, fda, fdaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAS0 (3-356)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3qm3f_
  • Chain 'G':
    Compound: Fructose-bisphosphate aldolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0597, fba, fda, fdaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAS0 (3-356)
      • expression tag (2)
    Domains in SCOPe 2.01: d3qm3g_
  • Chain 'H':
    Compound: Fructose-bisphosphate aldolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0597, fba, fda, fdaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAS0 (3-356)
      • expression tag (2)
    Domains in SCOPe 2.01: d3qm3h_
  • Heterogens: ZN, FMT, SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qm3A (A:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggee
    dgvdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilk
    nsqkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvre
    yelknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm3A (A:)
    amgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspviiq
    fsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidglie
    anaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggdntg
    idnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilknsqkfvk
    dkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknra
    ylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qm3B (B:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggee
    dgvdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilk
    nsqkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvre
    yelknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm3B (B:)
    amgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspviiq
    fsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidglie
    anaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggntgi
    dnsklytqpedvalayerlgkisdkfsiaasfgnvhgvvslqpeilknsqkfvkdkfaln
    sdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknraylqgqi
    gnpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qm3C (C:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggee
    dgvdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilk
    nsqkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvre
    yelknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm3C (C:)
    amgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspviiq
    fsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidglie
    anaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggdntg
    idnsklytqpedvalayerlgkisdkfsiaasfgnvhgvslqpeilknsqkfvkdkfaln
    sdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknraylqgqi
    gnpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qm3D (D:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggee
    dgvdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilk
    nsqkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvre
    yelknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm3D (D:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggtg
    idnsklytqpedvalayerlgkisdkfsiaasfgnvhgvslqpeilknsqkfvkdkfaln
    sdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknraylqgqi
    gnpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qm3E (E:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggee
    dgvdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilk
    nsqkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvre
    yelknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm3E (E:)
    amgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspviiq
    fsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidglie
    anaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggdntg
    idnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilknsqkfvk
    dkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknra
    ylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3qm3F (F:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggee
    dgvdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilk
    nsqkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvre
    yelknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm3F (F:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctgggi
    dnsklytqpedvalayerlgkisdkfsiaasfgnvhgvslqpeilknsqkfvkdkfalns
    dkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknraylqgqig
    npegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3qm3G (G:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggee
    dgvdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilk
    nsqkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvre
    yelknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm3G (G:)
    amgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspviiq
    fsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidglie
    anaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggdntg
    idnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilknsqkfvk
    dkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknra
    ylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3qm3H (H:)
    snamgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspvi
    iqfsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidgl
    ieanaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggee
    dgvdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilk
    nsqkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvre
    yelknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm3H (H:)
    amgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspviiq
    fsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidglie
    anaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctgidnsk
    lytqpedvalayerlgkisdkfsiaasfgnvhgvslqpeilknsqkfvkdkfalnsdkpi
    nfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknraylqgqignpeg
    ddkpnkkyydprvwlrsgeesmikrleiafedlncinkn