PDB entry 3qlt

View 3qlt on RCSB PDB site
Description: Crystal structure of a GluK2 (GluR6) glycan wedge homodimer assembly
Class: membrane protein
Keywords: Membrane protein, Glycosylation
Deposited on 2011-02-03, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.244
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor, ionotropic kainate 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Glur6, Grik2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42260
      • engineered mutation (212)
      • engineered mutation (214)
    Domains in SCOPe 2.07: d3qlta_
  • Chain 'B':
    Compound: Glutamate receptor, ionotropic kainate 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Glur6, Grik2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42260
      • engineered mutation (212)
      • engineered mutation (214)
    Domains in SCOPe 2.07: d3qltb_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qltA (A:)
    tthvlrfggifeyvesgpmgaeelafrfavntinrnrtllpnttltydtqkinlydsfea
    skkacdqlslgvaaifgpshsssanavqsicnalgvphiqtrwkhqvsdnkdsfyvslyp
    dfsslsraildlvqffkwktvtvvyddstglirlqelikapsrynlrlkirqlpadtkda
    kpllkemkrgkefhvifdcshemaagilkqalnmsmmteyyhyifttldlfaldvepyry
    sgvnmtgfrilntentqvssiiekwsmerlqappkpdsglldgfmttdaalmydavhvvs
    vavqqfpqmtvsslqcnrhkpwrfgtrfmslikeahwegltgritfnktnglrtdfdldv
    islkeeglekigtwdpasglnmtesqkgklelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qltA (A:)
    vlrfggifeyvpmgaeelafrfavntinrnrtllpnttltydtqkinlydsfeaskkacd
    qlslgvaaifgpshsssanavqsicnalgvphiqtrwkhqvsdnkdsfyvslypdfssls
    raildlvqffkwktvtvvyddstglirlqelikapsrynlrlkirqlpadtkdakpllke
    mkrgkefhvifdcshemaagilkqalnmsmmteyyhyifttldlfaldvepyrysgvnmt
    gfrilntentqvssiiekwsmepdsglldgfmttdaalmydavhvvsvavqqfpqmtvss
    lqcnrhkpwrfgtrfmslikeahwegltgritfnktnglrtdfdldvislkeeglekigt
    wdpasglnmte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qltB (B:)
    tthvlrfggifeyvesgpmgaeelafrfavntinrnrtllpnttltydtqkinlydsfea
    skkacdqlslgvaaifgpshsssanavqsicnalgvphiqtrwkhqvsdnkdsfyvslyp
    dfsslsraildlvqffkwktvtvvyddstglirlqelikapsrynlrlkirqlpadtkda
    kpllkemkrgkefhvifdcshemaagilkqalnmsmmteyyhyifttldlfaldvepyry
    sgvnmtgfrilntentqvssiiekwsmerlqappkpdsglldgfmttdaalmydavhvvs
    vavqqfpqmtvsslqcnrhkpwrfgtrfmslikeahwegltgritfnktnglrtdfdldv
    islkeeglekigtwdpasglnmtesqkgklelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qltB (B:)
    vlrfggifemgaeelafrfavntinrnrtllpttltydtqkinlydsfeaskkacdqlsl
    gvaaifgpshsssanavqsicnalgvphiqtrwkhqvsdnkdsfyvslypdfsslsrail
    dlvqffkwktvtvvyddstglirlqelikapsrynlrlkirqlpdtkdakpllkemkrgk
    efhvifdcshemaagilkqalnmsmmteyyhyifttldlfaldvepyrysgvnmtgfril
    ntentqvssiiekwsmerpdsglldgfmttdaalmydavhvvsvavqqfpqmtvsslqcn
    rhkpwrfgtrfmslikeahwegltgritfnktnglrtdfdldvislkeeglekigtwdpa
    sglnmte