PDB entry 3ql0

View 3ql0 on RCSB PDB site
Description: Crystal structure of N23PP/S148A mutant of E. coli dihydrofolate reductase
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2011-02-02, released 2011-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.21
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:364106]
    Gene: folA, UTI89_C0054
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RGF0 (0-159)
      • engineered mutation (22)
      • insertion (22)
      • engineered mutation (148)
    Domains in SCOPe 2.08: d3ql0a_
  • Heterogens: FOL, NAP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ql0A (A:)
misliaalavdrvigmenampwpplpadlawfkrntlnkpvimgrhtwesigrplpgrkn
iilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaev
egdthfpdyepddwesvfsefhdadaqnahsycfeilerr