PDB entry 3qkl

View 3qkl on RCSB PDB site
Description: Spirochromane Akt Inhibitors
Class: transferase/transferase inhibitor
Keywords: Kinase Domain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-02-01, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAC-alpha serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT1, PKB, RAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31749 (4-End)
      • engineered mutation (333)
      • conflict (338)
    Domains in SCOPe 2.06: d3qkla_
  • Chain 'C':
    Compound: GSK-3 beta peptide
    Species:
    Gene:
  • Heterogens: SMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qklA (A:)
    gamarvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtlten
    rvlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivs
    aldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksl
    lsgllkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfd
    eeftaqmititppdqddsmecvdserrphfpqfdysassta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qklA (A:)
    rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
    nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
    lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
    ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
    lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
    aqmitrphfpqfdysass
    

  • Chain 'C':
    No sequence available.