PDB entry 3qk9

View 3qk9 on RCSB PDB site
Description: Yeast Tim44 C-terminal domain complexed with Cymal-3
Class: protein transport
Keywords: Mitochondrion, PROTEIN TRANSPORT
Deposited on 2011-01-31, released 2011-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.312
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial import inner membrane translocase subunit TIM44
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TIM44, ISP45, MIM44, MPI1, YIL022W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qk9a_
  • Chain 'B':
    Compound: Mitochondrial import inner membrane translocase subunit TIM44
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TIM44, ISP45, MIM44, MPI1, YIL022W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qk9b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qk9A (A:)
    tnieskesfgkkvedfkektvvgrsiqslknklwdesenplivvmrkitnkvggffaete
    ssrvysqfklmdptfsnesftrhlreyivpeileayvkgdvkvlkkwfseapfnvyaaqq
    kifkeqdvyadgrildirgveivsakllapqdipvlvvgcraqeinlyrkkktgeiaagd
    eanilmssyamvftrdpeqidddetegwkilefvrggsrqft
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qk9A (A:)
    qslknklwdesenplivvmrkitnessrvysqfkfsnesftrhlreyivpeileayvkgd
    vkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivsakllapqdipvlvvgc
    raqeinlyrkkktgeiaagdeanilmssyamvftrdpegwkilefvrggsrqft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qk9B (B:)
    tnieskesfgkkvedfkektvvgrsiqslknklwdesenplivvmrkitnkvggffaete
    ssrvysqfklmdptfsnesftrhlreyivpeileayvkgdvkvlkkwfseapfnvyaaqq
    kifkeqdvyadgrildirgveivsakllapqdipvlvvgcraqeinlyrkkktgeiaagd
    eanilmssyamvftrdpeqidddetegwkilefvrggsrqft
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qk9B (B:)
    iqslknklwdesenplivvmrkitnessrvysqfkfsnesftrhlreyivpeileayvkg
    dvkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivsakllapqdipvlvvg
    craqeinlyrkkktgeiaagdeanilmssyamvftrdpegwkilefvrggsrqft