PDB entry 3qk3

View 3qk3 on RCSB PDB site
Description: Crystal structure of human beta-crystallin B3
Class: structural protein
Keywords: CRYBB3, crystallin, beta B3, cataract, eye lens protein, Structural Genomics, Structural Genomics Consortium, SGC, STRUCTURAL PROTEIN
Deposited on 2011-01-31, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-crystallin B3
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYBB3, CRYB3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qk3a_
  • Chain 'B':
    Compound: Beta-crystallin B3
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYBB3, CRYB3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qk3b_
  • Chain 'C':
    Compound: Beta-crystallin B3
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYBB3, CRYB3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qk3c_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qk3A (A:)
    yfqsmggsykvilyelenfqgkrcelsaecpsltdsllekvgsiqvesgpwlafesrafr
    geqfvlekgdyprwdawsnsrdsdsllslrplnidsphhklhlfenpafsgrkmeivddd
    vpslwahgfqdrvasvraingtwvgyefpgyrgrqyvfergeyrhwnewdasqpqlqsvr
    rird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qk3A (A:)
    sykvilyelenfqgkrcelsaecpsltllekvgsiqvesgpwlafesrafrgeqfvlekg
    dyprwdawsnsrdsdsllslrplnidsphhklhlfenpafsgrkmeivdddvpslwahgf
    qdrvasvraingtwvgyefpgyrgrqyvfergeyrhwnewdasqpqlqsvrrird
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qk3B (B:)
    yfqsmggsykvilyelenfqgkrcelsaecpsltdsllekvgsiqvesgpwlafesrafr
    geqfvlekgdyprwdawsnsrdsdsllslrplnidsphhklhlfenpafsgrkmeivddd
    vpslwahgfqdrvasvraingtwvgyefpgyrgrqyvfergeyrhwnewdasqpqlqsvr
    rird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qk3B (B:)
    sykvilyelenfqgkrcelsaecpsltdsllekvgsiqvesgpwlafesrafrgeqfvle
    kgdyprwdawsnsrdsdsllslrplnidsphhklhlfenpafsgrkmeivdddvpslwah
    gfqdrvasvraingtwvgyefpgyrgrqyvfergeyrhwnewdasqpqlqsvrrir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qk3C (C:)
    yfqsmggsykvilyelenfqgkrcelsaecpsltdsllekvgsiqvesgpwlafesrafr
    geqfvlekgdyprwdawsnsrdsdsllslrplnidsphhklhlfenpafsgrkmeivddd
    vpslwahgfqdrvasvraingtwvgyefpgyrgrqyvfergeyrhwnewdasqpqlqsvr
    rird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qk3C (C:)
    sykvilyelenfqgkrcelsaecpsltdsllekvgsiqvesgpwlafesrafrgeqfvle
    kgdyprwdawsnsrdsdsllslrplnidsphhklhlfenpafsgrkmeivdddvpslwah
    gfqdrvasvraingtwvgyefpgyrgrqyvfergeyrhwnewdasqpqlqsvrrir