PDB entry 3qk2

View 3qk2 on RCSB PDB site
Description: Structure-Based Analysis of the Interaction between the Simian Virus 40 T-Antigen Origin Binding Domain and Single-Stranded DNA
Class: DNA binding protein
Keywords: origin binding domain, DNA replication, DNA BINDING PROTEIN
Deposited on 2011-01-31, released 2011-02-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.165
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03070 (2-131)
      • expression tag (0-1)
      • expression tag (132)
    Domains in SCOPe 2.01: d3qk2a_
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3qk2A (A:)
gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
pgglkehdfnpess

    Sequence, based on observed residues (ATOM records): (download) 
    >3qk2A (A:)
gskvedpkdfpsellsflshafsnrtlacfaiyttkekaallykkimekysvtfisrhns
ynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslp
gglkehdfnpes