PDB entry 3qk1

View 3qk1 on RCSB PDB site
Description: Crystal Structure of Enterokinase-like Trypsin Variant
Class: hydrolase
Keywords: enzyme design, serine proteinase, substrate selectivity, autoactivation, designed protease, HYDROLASE
Deposited on 2011-01-31, released 2011-03-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (77-80)
      • expression tag (223)
    Domains in SCOPe 2.01: d3qk1a_
  • Heterogens: CA, SO4, EDO, IMD, GOL, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qk1A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynkrrknndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qk1A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynkrrknndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasnh