PDB entry 3qij

View 3qij on RCSB PDB site
Description: Primitive-monoclinic crystal structure of the FERM domain of protein 4.1R
Class: structural protein
Keywords: cytoskeleton, Structural Genomics, Structural Genomics Consortium, SGC, STRUCTURAL PROTEIN
Deposited on 2011-01-27, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein 4.1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPB41, E41P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11171 (18-295)
      • expression tag (16-17)
    Domains in SCOPe 2.07: d3qija1, d3qija2, d3qija3, d3qija4
  • Chain 'B':
    Compound: Protein 4.1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPB41, E41P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11171 (18-295)
      • expression tag (15-17)
    Domains in SCOPe 2.07: d3qijb1, d3qijb2, d3qijb3, d3qijb4
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qijA (A:)
    mhhhhhhssgrenlyfqghckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfg
    laiwdnatsktwldsakeikkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqd
    ivagrlpcsfatlallgsytiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhk
    syrsmtpaqadleflenakklsmygvdlhkakdlegvdiilgvcssgllvykdklrinrf
    pwpkvlkisykrssffikirpgeqeqyestigfklpsyraakklwkvcvehhtffr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qijA (A:)
    qghckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsa
    keikkqvpwnftfnvkfyppdpaqlteditryylclqlrqdivagrlpcsfatlallgsy
    tiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhksyrsmtpaqadleflenak
    klsmygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffiki
    restigfklpsyraakklwkvcvehhtffr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qijB (B:)
    mhhhhhhssgrenlyfqghckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfg
    laiwdnatsktwldsakeikkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqd
    ivagrlpcsfatlallgsytiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhk
    syrsmtpaqadleflenakklsmygvdlhkakdlegvdiilgvcssgllvykdklrinrf
    pwpkvlkisykrssffikirpgeqeqyestigfklpsyraakklwkvcvehhtffr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qijB (B:)
    fqghckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdktwldsakei
    kkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqdivagrlpcsfatlallgsy
    tiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhksyrsmtpaqadleflenak
    klsmygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffiki
    rpqyestigfklpsyraakklwkvcvehhtffr