PDB entry 3qhz

View 3qhz on RCSB PDB site
Description: Crystal Structure of human anti-influenza Fab 2D1
Class: immune system
Keywords: Immunoglobulin, Immune recognition, Influenza A hemagglutinin, IMMUNE SYSTEM
Deposited on 2011-01-26, released 2011-02-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.181
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Human monoclonal antibody del2D1, Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin gamma
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHZ (0-228)
  • Chain 'I':
    Compound: Human monoclonal antibody del2D1, Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin gamma
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHZ
  • Chain 'L':
    Compound: Human monoclonal antibody del2D1, Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin lambda
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHZ (Start-216)
    Domains in SCOPe 2.04: d3qhzl1, d3qhzl2
  • Chain 'M':
    Compound: Human monoclonal antibody del2D1, Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin lambda
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHZ
    Domains in SCOPe 2.04: d3qhzm1, d3qhzm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qhzL (L:)
    qpvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvp
    drfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhzL (L:)
    pvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvpd
    rfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3qhzM (M:)
    qpvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvp
    drfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhzM (M:)
    ltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvpdrf
    sgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshksyscqvthegstvektvapt