PDB entry 3qhx

View 3qhx on RCSB PDB site
Description: Crystal Structure of Cystathionine gamma-synthase MetB (Cgs) from Mycobacterium ulcerans Agy99 bound to HEPES
Class: lyase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, CGS_like, AAT_I superfamily, LLP, PLP, LYASE
Deposited on 2011-01-26, released 2011-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-synthase MetB (Cgs)
    Species: Mycobacterium ulcerans [TaxId:362242]
    Gene: metB, MUL_0201
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3qhxa_
  • Chain 'B':
    Compound: Cystathionine gamma-synthase MetB (Cgs)
    Species: Mycobacterium ulcerans [TaxId:362242]
    Gene: metB, MUL_0201
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3qhxb_
  • Chain 'C':
    Compound: Cystathionine gamma-synthase MetB (Cgs)
    Species: Mycobacterium ulcerans [TaxId:362242]
    Gene: metB, MUL_0201
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3qhxc_
  • Chain 'D':
    Compound: Cystathionine gamma-synthase MetB (Cgs)
    Species: Mycobacterium ulcerans [TaxId:362242]
    Gene: metB, MUL_0201
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3qhxd_
  • Heterogens: SO4, EPE, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qhxA (A:)
    gpgsmkddhkaqhrfaglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyey
    artgnptrtaleaalaavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfr
    lidkvftgwnveytpvaladldavraairpttrliwvetptnpllsiadiagiaqlgads
    sakvlvdntfaspalqqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflq
    ngagavpgpfdayltmrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpgh
    avaarqmrgfggmvsvrmragrtaaeqlcaktnifilaeslgsvesliehpsamthasta
    gsqlevpddlvrlsvgiedvadllddlkqalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhxA (A:)
    aglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyeyartgnptrtaleaal
    aavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfrlidkvftgwnveytp
    valadldavraairpttrliwvetptnpllsiadiagiaqlgadssakvlvdntfaspal
    qqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflqngagavpgpfdaylt
    mrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpghavaarqmrgfggmvs
    vrmragrtaaeqlcaktnifilaeslgsvesliehpsamthastagsqlevpddlvrlsv
    giedvadllddlkqalg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qhxB (B:)
    gpgsmkddhkaqhrfaglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyey
    artgnptrtaleaalaavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfr
    lidkvftgwnveytpvaladldavraairpttrliwvetptnpllsiadiagiaqlgads
    sakvlvdntfaspalqqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflq
    ngagavpgpfdayltmrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpgh
    avaarqmrgfggmvsvrmragrtaaeqlcaktnifilaeslgsvesliehpsamthasta
    gsqlevpddlvrlsvgiedvadllddlkqalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhxB (B:)
    aglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyeyartgnptrtaleaal
    aavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfrlidkvftgwnveytp
    valadldavraairpttrliwvetptnpllsiadiagiaqlgadssakvlvdntfaspal
    qqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflqngagavpgpfdaylt
    mrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpghavaarqmrgfggmvs
    vrmragrtaaeqlcaktnifilaeslgsvesliehpsagsqlevpddlvrlsvgiedvad
    llddlkqalg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qhxC (C:)
    gpgsmkddhkaqhrfaglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyey
    artgnptrtaleaalaavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfr
    lidkvftgwnveytpvaladldavraairpttrliwvetptnpllsiadiagiaqlgads
    sakvlvdntfaspalqqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflq
    ngagavpgpfdayltmrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpgh
    avaarqmrgfggmvsvrmragrtaaeqlcaktnifilaeslgsvesliehpsamthasta
    gsqlevpddlvrlsvgiedvadllddlkqalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhxC (C:)
    aglatraihsgyrpdpatgavnapiyasstfaqdglrggyeyartgnptrtaleaalaav
    edaafgrafssgmaaadcalramlrpgdhvvipddayggtfrlidkvftgwnveytpval
    adldavraairpttrliwvetptnpllsiadiagiaqlgadssakvlvdntfaspalqqp
    lslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflqngagavpgpfdayltmrg
    lktlvlrmqrhsenaaavaeflaehpaistvlypglpshpghavaarqmrgfggmvsvrm
    ragrtaaeqlcaktnifilaeslgsvesliehpsamtgsqlevpddlvrlsvgiedvadl
    lddlkqalg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qhxD (D:)
    gpgsmkddhkaqhrfaglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyey
    artgnptrtaleaalaavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfr
    lidkvftgwnveytpvaladldavraairpttrliwvetptnpllsiadiagiaqlgads
    sakvlvdntfaspalqqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflq
    ngagavpgpfdayltmrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpgh
    avaarqmrgfggmvsvrmragrtaaeqlcaktnifilaeslgsvesliehpsamthasta
    gsqlevpddlvrlsvgiedvadllddlkqalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhxD (D:)
    aglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyeyartgnptrtaleaal
    aavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfrlidkvftgwnveytp
    valadldavraairpttrliwvetptnpllsiadiagiaqlgadssakvlvdntfaspal
    qqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflqngagavpgpfdaylt
    mrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpghavaarqmrgfggmvs
    vrmragrtaaeqlcaktnifilaeslgsvesliehpsamthastagsqlevpddlvrlsv
    giedvadllddlkqalg