PDB entry 3qht

View 3qht on RCSB PDB site
Description: Crystal Structure of the Monobody ySMB-1 bound to yeast SUMO
Class: de novo protein
Keywords: Fibronectin Type III, yeast small ubiquitin-like modifier, SMT3, DE NOVO PROTEIN
Deposited on 2011-01-26, released 2011-05-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SMT3, YDR510W, D9719.15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qhta_
  • Chain 'B':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SMT3, YDR510W, D9719.15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qhtb_
  • Chain 'C':
    Compound: Monobody ySMB-1
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHT (Start-96)
  • Chain 'D':
    Compound: Monobody ySMB-1
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHT (Start-96)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qhtA (A:)
    gsdsevnqeakpevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkem
    dslrflydgiriqadqtpedldmedndiieahreqigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhtA (A:)
    kpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtp
    edldmedndiieahreqig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qhtB (B:)
    gsdsevnqeakpevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkem
    dslrflydgiriqadqtpedldmedndiieahreqigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhtB (B:)
    thinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedl
    dmedndiieahre
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.