PDB entry 3qhr

View 3qhr on RCSB PDB site
Description: Structure of a pCDK2/CyclinA transition-state mimic
Class: transferase/protein binding
Keywords: kinase catalytic domain, protein kinase, Cyclin, Phosphorylated Thr-160, TRANSFERASE-PROTEIN BINDING complex
Deposited on 2011-01-26, released 2011-05-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.18
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cell division protein kinase 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CDK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24941 (2-297)
    • expression tag (0-1)
  Domains in SCOPe 2.04: d3qhra_
• Chain 'B':
  Compound: Cyclin-A2
  Species: Mus musculus [TaxId:10090]
  Gene: Ccna2, Ccna, Cyca
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51943 (1-260)
    • expression tag (0)
• Chain 'C':
  Compound: Cell division protein kinase 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CDK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24941 (2-297)
    • expression tag (0-1)
  Domains in SCOPe 2.04: d3qhrc_
• Chain 'D':
  Compound: Cyclin-A2
  Species: Mus musculus [TaxId:10090]
  Gene: Ccna2, Ccna, Cyca
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51943 (1-260)
    • expression tag (0)
• Chain 'J':
  Compound: CDK2 substrate peptide: PKTPKKAKKL
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3QHR (0-9)
• Chain 'K':
  Compound: CDK2 substrate peptide: PKTPKKAKKL
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3QHR (0-9)
• Chain 'L':
  Compound: CDK2 substrate peptide: PKTPKKAKKL
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3QHR (0-9)
• Chain 'M':
  Compound: CDK2 substrate peptide: PKTPKKAKKL
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3QHR (0-9)
• Heterogens: ADP, MG, MGF, CL, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qhrA (A:)
  ghmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
  nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
  hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
  yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
  sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qhrC (C:)
  ghmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
  nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
  hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
  yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
  sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.