PDB entry 3qhf

View 3qhf on RCSB PDB site
Description: Crystal Structure of Fab del2D1, a deletion variant of anti-influenza antibody 2D1
Class: immune system
Keywords: Immunoglobulin, Immune recognition, Influenza A virus hemagglutinin, Extracellular (secreted), IMMUNE SYSTEM
Deposited on 2011-01-25, released 2011-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.6600000000000001 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Human monoclonal antibody del2D1, Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin gamma
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHF (0-End)
    Domains in SCOPe 2.08: d3qhfh_
  • Chain 'L':
    Compound: Human monoclonal antibody del2D1, Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin lambda
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHF (0-End)
    Domains in SCOPe 2.08: d3qhfl1, d3qhfl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3qhfH (H:)
    evqlvesgpalvkptqtltltcsfsgfslstsgmsvswirqppgkalewlalidwdddty
    yssslktrltiskdtsksqvvltmtnmdpvdtatyycartlrvsgdyvrdfdlwgrgtlv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhfH (H:)
    evqlvesgpalvkptqtltltcsfsgfslstsgmsvswirqppgkalewlalidwdddty
    yssslktrltiskdtsksqvvltmtnmdpvdtatyycartlrvsgdyvrdfdlwgrgtlv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qhfL (L:)
    epvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvp
    drfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qhfL (L:)
    epvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvp
    drfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshksyscqvthegstvektvapte