PDB entry 3qh3

View 3qh3 on RCSB PDB site
Description: The crystal structure of TCR A6
Class: immune system
Keywords: TAX peptide, Tel1p peptide, nonapeptide, MHC class I, HLA-A2, TCR A6, cross-reactivity, IMMUNE SYSTEM
Deposited on 2011-01-25, released 2012-01-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A6 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QH3 (0-193)
    Domains in SCOPe 2.04: d3qh3a1, d3qh3a2
  • Chain 'B':
    Compound: A6 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QH3 (0-244)
    Domains in SCOPe 2.04: d3qh3b1, d3qh3b2
  • Chain 'C':
    Compound: A6 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QH3 (0-193)
    Domains in SCOPe 2.04: d3qh3c1, d3qh3c2
  • Chain 'D':
    Compound: A6 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QH3 (0-244)
    Domains in SCOPe 2.04: d3qh3d1, d3qh3d2
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qh3A (A:)
    keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
    taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpdiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qh3B (B:)
    nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
    pngynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvtedlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qh3C (C:)
    keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
    taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpdiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qh3D (D:)
    nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
    pngynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvtedlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qh3D (D:)
    nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev
    pngynvsrsttedfplrllsaapsqtsvyfcasrpglpeqyfgpgtrltvtedlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d