PDB entry 3qgm

View 3qgm on RCSB PDB site
Description: p-nitrophenyl phosphatase from Archaeoglobus fulgidus
Class: hydrolase
Keywords: structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2011-01-24, released 2011-02-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-nitrophenyl phosphatase (Pho2)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qgma_
  • Chain 'B':
    Compound: p-nitrophenyl phosphatase (Pho2)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qgmb_
  • Chain 'C':
    Compound: p-nitrophenyl phosphatase (Pho2)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qgmc_
  • Chain 'D':
    Compound: p-nitrophenyl phosphatase (Pho2)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qgmd_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qgmA (A:)
    snammpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrriller
    lrsfglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaey
    lvvgsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgre
    pdvvvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttren
    ldqmierhglkpdyvfnslkdmvealeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qgmA (A:)
    pdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrsfg
    levgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvvgs
    nrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdvvv
    gkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldqmi
    erhglkpdyvfnslkdmveal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qgmB (B:)
    snammpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrriller
    lrsfglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaey
    lvvgsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgre
    pdvvvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttren
    ldqmierhglkpdyvfnslkdmvealeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qgmB (B:)
    pdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrsfg
    levgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvvgs
    nrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdvvv
    gkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldqmi
    erhglkpdyvfnslkdmveal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qgmC (C:)
    snammpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrriller
    lrsfglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaey
    lvvgsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgre
    pdvvvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttren
    ldqmierhglkpdyvfnslkdmvealeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qgmC (C:)
    mpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrsf
    glevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvvg
    snrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdvv
    vgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldqm
    ierhglkpdyvfnslkdmveal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qgmD (D:)
    snammpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrriller
    lrsfglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaey
    lvvgsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgre
    pdvvvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttren
    ldqmierhglkpdyvfnslkdmvealeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qgmD (D:)
    mpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrsf
    glevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvvg
    snrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdvv
    vgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldqm
    ierhglkpdyvfnslkdmveal