PDB entry 3qfq

View 3qfq on RCSB PDB site
Description: Asymmetric Assembly of Merkel Cell Polyomavirus Large T-antigen Origin Binding Domains at the Viral Origin
Class: DNA binding protein/DNA
Keywords: Origin binding domain, protein-DNA complex, replication, DNA BINDING PROTEIN-DNA complex
Deposited on 2011-01-22, released 2011-04-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: large t antigen
  Species: Merkel cell polyomavirus [TaxId:493803]
  Database cross-references and differences (RAF-indexed):
  • Uniprot E2IPT4
• Chain 'B':
  Compound: large t antigen
  Species: Merkel cell polyomavirus [TaxId:493803]
  Database cross-references and differences (RAF-indexed):
  • Uniprot E2IPT4
• Chain 'C':
  Compound: DNA (26-mer)
  Species: synthetic, synthetic
  
• Chain 'E':
  Compound: large t antigen
  Species: Merkel cell polyomavirus [TaxId:493803]
  Database cross-references and differences (RAF-indexed):
  • Uniprot E2IPT4
  Domains in SCOPe 2.02: d3qfqe_
• Chain 'W':
  Compound: DNA (26-mer)
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >3qfqE (E:)
  mghhhhhhgetpvptdfpidlsdylshavysnktvscfaiyttsdkaielydkiekfkvd
  fksrhacelgcillfitlskhrvsaiknfcstfctisflickgvnkmpemynnlckppyk
  llqenkpllnyefqe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3qfqE (E:)
  vptdfpidlsdylshavysnktvscfaiyttsdkaielydkiekfkvdfksrhacelgci
  llfitlskhrvsaiknfcstfctisflickgvnkmpemynnlckppykllqenkpll
  

  
  
• Chain 'W':
  No sequence available.