PDB entry 3qf0

View 3qf0 on RCSB PDB site
Description: Crystal structure of the mutant T159V,Y206F of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
Class: lyase/lyase inhibitor
Keywords: (beta-alpha)8 barrel, orotidine 5'-monophosphate decarboxylase, inhibitor BMP, LYASE-LYASE INHIBITOR complex
Deposited on 2011-01-20, released 2012-01-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.174
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
      • engineered mutation (158)
      • engineered mutation (205)
    Domains in SCOPe 2.02: d3qf0a_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
      • engineered mutation (158)
      • engineered mutation (205)
    Domains in SCOPe 2.02: d3qf0b_
  • Heterogens: BMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qf0A (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpsvrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsifladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qf0A (A:)
    dvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcr
    iiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltem
    shpgaemfiqgaadeiarmgvdlgvknyvgpsvrperlsrlreiigqdsflispgvgaqg
    gdpgetlrfadaiivgrsifladnpaaaaagiiesikdll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qf0B (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpsvrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsifladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qf0B (B:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpsvrperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsifladnpaaaaagiiesikdll