PDB entry 3qej

View 3qej on RCSB PDB site
Description: S74E-dCK mutant in complex with UDP
Class: transferase
Keywords: alpha/beta, phosphoryl transfer, ATP binding, phosphorylation, TRANSFERASE
Deposited on 2011-01-20, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.204
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deoxycytidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: DCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27707 (Start-278)
      • variant (63)
      • variant (77)
      • engineered mutation (92)
      • variant (164)
    Domains in SCOPe 2.07: d3qeja_
  • Chain 'B':
    Compound: Deoxycytidine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: DCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27707 (Start-278)
      • variant (63)
      • variant (77)
      • engineered mutation (92)
      • variant (164)
    Domains in SCOPe 2.07: d3qejb_
  • Heterogens: UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qejA (A:)
    mgsshhhhhhsglvprgshmatppkrsspsfsassegtrikkisiegniaagkstfvnil
    kqlsedwevvpepvarwsnvqstqdefeeltmeqknggnvlqmmyekperwsftfqtyac
    lsriraqlaslngklkdaekpvlffersvysdryifasnlyesesmnetewtiyqdwhdw
    mnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhykheswllhrtl
    ktnfdylqevpiltldvnedfkdkyeslvekvkeflstl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qejA (A:)
    trikkisiegniaagkstfvnilkqlsedwevvpepvarwsnveltmeqknggnvlqmmy
    ekperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyeses
    mnetewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyle
    klhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qejB (B:)
    mgsshhhhhhsglvprgshmatppkrsspsfsassegtrikkisiegniaagkstfvnil
    kqlsedwevvpepvarwsnvqstqdefeeltmeqknggnvlqmmyekperwsftfqtyac
    lsriraqlaslngklkdaekpvlffersvysdryifasnlyesesmnetewtiyqdwhdw
    mnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhykheswllhrtl
    ktnfdylqevpiltldvnedfkdkyeslvekvkeflstl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qejB (B:)
    trikkisiegniaagkstfvnilkqlsedwevvpepvarwsnvqltmeqknggnvlqmmy
    ekperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyeses
    mnetewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyle
    klhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl