PDB entry 3qeh

View 3qeh on RCSB PDB site
Description: Crystal structure of human N12-i15, an ADCC and non-neutralizing anti-HIV-1 Env antibody
Class: immune system
Keywords: ADCC and non-neutralizing anti-HIV-1 Env antibody N12-i15, CD4i antibody, Fab fragment, binds to viral glycoprotein gp120, IMMUNE SYSTEM
Deposited on 2011-01-20, released 2012-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab fragment of human anti-HIV-1 Env antibody N12-i15, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEH (0-End)
  • Chain 'B':
    Compound: Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEH (0-End)
    Domains in SCOPe 2.06: d3qehb1, d3qehb2
  • Chain 'C':
    Compound: Fab fragment of human anti-HIV-1 Env antibody N12-i15, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEH (0-End)
  • Chain 'D':
    Compound: Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEH (0-End)
    Domains in SCOPe 2.06: d3qehd1, d3qehd2
  • Chain 'E':
    Compound: Fab fragment of human anti-HIV-1 Env antibody N12-i15, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEH (0-End)
  • Chain 'F':
    Compound: Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEH (0-End)
    Domains in SCOPe 2.06: d3qehf1, d3qehf2
  • Chain 'G':
    Compound: Fab fragment of human anti-HIV-1 Env antibody N12-i15, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEH (0-End)
  • Chain 'H':
    Compound: Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEH
    Domains in SCOPe 2.06: d3qehh1, d3qehh2
  • Heterogens: SO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qehB (B:)
    divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra
    tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qehB (B:)
    divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra
    tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qehD (D:)
    divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra
    tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qehD (D:)
    divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra
    tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3qehF (F:)
    divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra
    tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qehF (F:)
    divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra
    tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3qehH (H:)
    divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra
    tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qehH (H:)
    ivmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnrat
    gvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveikrtvaapsvfi
    fppdeqlkssvvcllnnfpreqwkqsgnsqesvteqdskdstyslsstladyekhyacev
    thqglpvtksfnr