PDB entry 3qdu

View 3qdu on RCSB PDB site
Description: Structure of Boletus edulis lectin in complex with N,N-diacetyl chitobiose
Class: sugar binding protein
Keywords: Boletus edulis, lectin, mushroom, T-antigen disaccharide, N,N-diacetyl chitobiose, Carbohydrate, Sugar Binding, SUGAR BINDING PROTEIN
Deposited on 2011-01-19, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: boletus edulis lectin
    Species: Boletus edulis [TaxId:36056]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QDU (Start-141)
    Domains in SCOPe 2.07: d3qdua_
  • Chain 'B':
    Compound: boletus edulis lectin
    Species: Boletus edulis [TaxId:36056]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QDU (Start-141)
    Domains in SCOPe 2.07: d3qdub_
  • Chain 'C':
    Compound: boletus edulis lectin
    Species: Boletus edulis [TaxId:36056]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QDU (Start-141)
    Domains in SCOPe 2.07: d3qduc_
  • Chain 'D':
    Compound: boletus edulis lectin
    Species: Boletus edulis [TaxId:36056]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QDU (Start-141)
    Domains in SCOPe 2.07: d3qdud_
  • Heterogens: CBS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qduA (A:)
    tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
    gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
    trfevkytvvegnnleanvifs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qduB (B:)
    tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
    gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
    trfevkytvvegnnleanvifs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qduC (C:)
    tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
    gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
    trfevkytvvegnnleanvifs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qduD (D:)
    tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
    gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
    trfevkytvvegnnleanvifs