PDB entry 3qdt

View 3qdt on RCSB PDB site
Description: Structure of Boletus edulis lectin in complex with T-antigen disaccharide
Class: sugar binding protein
Keywords: Boletus edulis, lectin, mushroom, T-antigen, Carbohydrate, SUGAR BINDING PROTEIN
Deposited on 2011-01-19, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.17
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: boletus edulis lectin
    Species: Boletus edulis [TaxId:36056]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QDT (Start-141)
    Domains in SCOPe 2.07: d3qdta_
  • Chain 'B':
    Compound: boletus edulis lectin
    Species: Boletus edulis [TaxId:36056]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QDT (Start-141)
    Domains in SCOPe 2.07: d3qdtb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qdtA (A:)
    tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
    gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
    trfevkytvvegnnleanvifs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qdtB (B:)
    tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
    gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
    trfevkytvvegnnleanvifs