PDB entry 3qda

View 3qda on RCSB PDB site
Description: Crystal structure of W95L beta-2 microglobulin
Class: immune system
Keywords: tryptophan, immunoglobin, beta-sandwich, hydrophobic pocket, amyloidosis, DRA, MHC class I, IMMUNE SYSTEM
Deposited on 2011-01-18, released 2011-06-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.149
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P, NM_004048
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • initiating methionine (0)
      • engineered mutation (95)
    Domains in SCOPe 2.02: d3qdaa_
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qdaA (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkldrdm