PDB entry 3qd8

View 3qd8 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis BfrB
Class: metal binding protein
Keywords: Ferritin, Iron binding protein, Iron storage, Metal binding protein
Deposited on 2011-01-18, released 2011-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8a_
  • Chain 'B':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8b1
  • Chain 'C':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8c1
  • Chain 'D':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8d1
  • Chain 'E':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8e1
  • Chain 'F':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8f1
  • Chain 'G':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8g1
  • Chain 'H':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8h1
  • Chain 'I':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8i1
  • Chain 'J':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8j1
  • Chain 'K':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8k1
  • Chain 'L':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8l1
  • Chain 'M':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8m1
  • Chain 'N':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8n1
  • Chain 'O':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8o1
  • Chain 'P':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8p1
  • Chain 'Q':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8q1
  • Chain 'R':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8r1
  • Chain 'S':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8s1
  • Chain 'T':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8t1
  • Chain 'U':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8u1
  • Chain 'V':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8v1
  • Chain 'W':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8w1
  • Chain 'X':
    Compound: Probable bacterioferritin BfrB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qd8x1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qd8A (A:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8A (A:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qd8B (B:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8B (B:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qd8C (C:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8C (C:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qd8D (D:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8D (D:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qd8E (E:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8E (E:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3qd8F (F:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8F (F:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3qd8G (G:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8G (G:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3qd8H (H:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8H (H:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3qd8I (I:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8I (I:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3qd8J (J:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8J (J:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3qd8K (K:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8K (K:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qd8L (L:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8L (L:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3qd8M (M:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8M (M:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3qd8N (N:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8N (N:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3qd8O (O:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8O (O:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3qd8P (P:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8P (P:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3qd8Q (Q:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8Q (Q:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3qd8R (R:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8R (R:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3qd8S (S:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8S (S:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3qd8T (T:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8T (T:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3qd8U (U:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8U (U:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3qd8V (V:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8V (V:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3qd8W (W:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8W (W:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3qd8X (X:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd8X (X:)
    kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
    dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
    qeqieevalmatlvrvadraganlfelenfvarephaaggrl