PDB entry 3qci

View 3qci on RCSB PDB site
Description: Human receptor protein tyrosine phosphatase gamma, domain 1, in complex with N-[(3-aminophenyl)sulfonyl]-3-[(3,4-dichlorobenzyl)sulfanyl]thiophene-2-carboxamide
Class: hydrolase/hydrolase inhibitor
Keywords: TYROSINE RECEPTOR PHOSPHATASE, TWISTED MIXED BETA-SHEETS FLANKED BY {ALPHA}-HELICES, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-01-16, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.24
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPG, PTPRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qcia_
  • Heterogens: NX3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qciA (A:)
    gshmgsmeaipvkqfvkhigelysnnqhgfsedfeevqrctadmnitaehsnhpenkhkn
    ryinilaydhsrvklrplpgkdskhsdyinanyvdgynkakayiatqgplkstfedfwrm
    iweqntgiivmitnlvekgrrkcdqywptenseeygniivtlkstkihacytvrrfsirn
    tkvkkgqkgnpkgrqnervviqyhytqwpdmgvpeyalpvltfvrrssaarmpetgpvlv
    hcsagvgrtgtyividsmlqqikdkstvnvlgflkhirtqrnylvqteeqyifihdalle
    ailgketevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qciA (A:)
    meaipvkqfvkhigelysnnqhgfsedfeevqrctadmnitaehsnhpenkhknryinil
    aydhsrvklrplpskhsdyinanyvdgynkakayiatqgplkstfedfwrmiweqntgii
    vmitnlvekgrrkcdqywptenseeygniivtlkstkihacytvrrfsirntkvkqnerv
    viqyhytqwpdmgvpeyalpvltfvrrssaarmpetgpvlvhcsagvgrtgtyividsml
    qqikdkstvnvlgflkhirtqrnylvqteeqyifihdalleailg