PDB entry 3qca

View 3qca on RCSB PDB site
Description: Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The Conserved FcisP Touch-Turn Motif of UBX Domain Suffering Conformational Change
Class: protein binding
Keywords: ubx, faf1, protein binding
Deposited on 2011-01-15, released 2011-05-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.249
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fas-associated factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3qcaa_
  • Chain 'B':
    Compound: fas-associated factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3qcab_
  • Chain 'C':
    Compound: fas-associated factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3qcac_
  • Chain 'D':
    Compound: fas-associated factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3qcad_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qcaA (A:)
    gsefepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtq
    ldpnksllevklfpqetlfleake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qcaA (A:)
    epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
    ksllevklfpqetlfleake
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qcaB (B:)
    gsefepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtq
    ldpnksllevklfpqetlfleake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qcaB (B:)
    epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
    ksllevklfpqetlfleake
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qcaC (C:)
    gsefepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtq
    ldpnksllevklfpqetlfleake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qcaC (C:)
    epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
    ksllevklfpqetlfleake
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qcaD (D:)
    gsefepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtq
    ldpnksllevklfpqetlfleake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qcaD (D:)
    epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
    ksllevklfpqetlfleake