PDB entry 3qc8

View 3qc8 on RCSB PDB site
Description: Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The Conserved FcisP Touch-Turn Motif of UBX Domain Suffering Conformational Change
Class: protein binding
Keywords: UBX domain, FAF1, p97, VCP, PROTEIN BINDING
Deposited on 2011-01-15, released 2011-07-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qc8a1, d3qc8a2
  • Chain 'B':
    Compound: fas-associated factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qc8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qc8A (A:)
    gsnrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcs
    dekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpy
    fleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qc8A (A:)
    pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki
    rmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyflea
    yrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qc8B (B:)
    gsefepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtq
    ldpnksllevklfpqetlfleake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qc8B (B:)
    epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
    ksllevklfpqetlfleake