PDB entry 3qan

View 3qan on RCSB PDB site
Description: Crystal structure of 1-pyrroline-5-carboxylate dehydrogenase from bacillus halodurans
Class: oxidoreductase
Keywords: PROLINE OXIDATION, REDOX CONTROL, APOPTOSIS, NAD BINDING, OXIDOREDUCTASE, PSI-Biology, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMICS RESEARCH CONSORTIUM (NYSGRC)
Deposited on 2011-01-11, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase 1
    Species: Bacillus halodurans [TaxId:86665]
    Gene: rocA1, BH2737
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K9B2 (1-515)
      • expression tag (0)
    Domains in SCOPe 2.07: d3qana1, d3qana2
  • Chain 'B':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase 1
    Species: Bacillus halodurans [TaxId:86665]
    Gene: rocA1, BH2737
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K9B2 (1-515)
      • expression tag (516)
    Domains in SCOPe 2.07: d3qanb1, d3qanb2
  • Chain 'C':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase 1
    Species: Bacillus halodurans [TaxId:86665]
    Gene: rocA1, BH2737
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K9B2 (Start-515)
      • expression tag (516)
    Domains in SCOPe 2.07: d3qanc1, d3qanc2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qanA (A:)
    vmlqpykhepftdftveanrkafeealglvekelgkeypliingervttedkiqswnpar
    kdqlvgsvskanqdlaekaiqsadeafqtwrnvnpeeranilvkaaaiirrrkhefsawl
    vheagkpwkeadadtaeaidfleyyarqmielnrgkeilsrpgeqnryfytpmgvtvtis
    pwnfalaimvgtavapivtgntvvlkpasttpvvaakfvevledaglpkgvinyvpgsga
    evgdylvdhpktslitftgskdvgvrlyeraavvrpgqnhlkrvivemggkdtvvvdrda
    dldlaaesilvsafgfsgqkcsagsravihkdvydevlektvalaknltvgdptnrdnym
    gpvidekafekimsyieigkkegrlmtggegdsstgffiqptiiadldpeavimqeeifg
    pvvafskandfdhaleiannteygltgavitrnrahieqakrefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktvsemyaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qanA (A:)
    vmlqpykhepftdftveanrkafeealglvekelgkeypliingervttedkiqswnpar
    kdqlvgsvskanqdlaekaiqsadeafqtwrnvnpeeranilvkaaaiirrrkhefsawl
    vheagkpwkeadadtaeaidfleyyarqmielnrgkeilsrpgeqnryfytpmgvtvtis
    pwnfalaimvgtavapivtgntvvlkpasttpvvaakfvevledaglpkgvinyvpgsga
    evgdylvdhpktslitftgskdvgvrlyeraavvrpgqnhlkrvivemggkdtvvvdrda
    dldlaaesilvsafgfsgqkcsagsravihkdvydevlektvalaknltvgdptnrdnym
    gpvidekafekimsyieigkkegrlmtggegdsstgffiqptiiadldpeavimqeeifg
    pvvafskandfdhaleiannteygltgavitrnrahieqakrefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktvsemy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qanB (B:)
    vmlqpykhepftdftveanrkafeealglvekelgkeypliingervttedkiqswnpar
    kdqlvgsvskanqdlaekaiqsadeafqtwrnvnpeeranilvkaaaiirrrkhefsawl
    vheagkpwkeadadtaeaidfleyyarqmielnrgkeilsrpgeqnryfytpmgvtvtis
    pwnfalaimvgtavapivtgntvvlkpasttpvvaakfvevledaglpkgvinyvpgsga
    evgdylvdhpktslitftgskdvgvrlyeraavvrpgqnhlkrvivemggkdtvvvdrda
    dldlaaesilvsafgfsgqkcsagsravihkdvydevlektvalaknltvgdptnrdnym
    gpvidekafekimsyieigkkegrlmtggegdsstgffiqptiiadldpeavimqeeifg
    pvvafskandfdhaleiannteygltgavitrnrahieqakrefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktvsemyaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qanB (B:)
    mlqpykhepftdftveanrkafeealglvekelgkeypliingervttedkiqswnpark
    dqlvgsvskanqdlaekaiqsadeafqtwrnvnpeeranilvkaaaiirrrkhefsawlv
    heagkpwkeadadtaeaidfleyyarqmielnrgkeilsrpgeqnryfytpmgvtvtisp
    wnfalaimvgtavapivtgntvvlkpasttpvvaakfvevledaglpkgvinyvpgsgae
    vgdylvdhpktslitftgskdvgvrlyeraavvrpgqnhlkrvivemggkdtvvvdrdad
    ldlaaesilvsafgfsgqkcsagsravihkdvydevlektvalaknltvgdptnrdnymg
    pvidekafekimsyieigkkegrlmtggegdsstgffiqptiiadldpeavimqeeifgp
    vvafskandfdhaleiannteygltgavitrnrahieqakrefhvgnlyfnrnctgaivg
    yhpfggfkmsgtdskaggpdylalhmqaktvsemya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qanC (C:)
    vmlqpykhepftdftveanrkafeealglvekelgkeypliingervttedkiqswnpar
    kdqlvgsvskanqdlaekaiqsadeafqtwrnvnpeeranilvkaaaiirrrkhefsawl
    vheagkpwkeadadtaeaidfleyyarqmielnrgkeilsrpgeqnryfytpmgvtvtis
    pwnfalaimvgtavapivtgntvvlkpasttpvvaakfvevledaglpkgvinyvpgsga
    evgdylvdhpktslitftgskdvgvrlyeraavvrpgqnhlkrvivemggkdtvvvdrda
    dldlaaesilvsafgfsgqkcsagsravihkdvydevlektvalaknltvgdptnrdnym
    gpvidekafekimsyieigkkegrlmtggegdsstgffiqptiiadldpeavimqeeifg
    pvvafskandfdhaleiannteygltgavitrnrahieqakrefhvgnlyfnrnctgaiv
    gyhpfggfkmsgtdskaggpdylalhmqaktvsemyaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qanC (C:)
    lqpykhepftdftveanrkafeealglvekelgkeypliingervttedkiqswnparkd
    qlvgsvskanqdlaekaiqsadeafqtwrnvnpeeranilvkaaaiirrrkhefsawlvh
    eagkpwkeadadtaeaidfleyyarqmielnrgkeilsrpgeqnryfytpmgvtvtispw
    nfalaimvgtavapivtgntvvlkpasttpvvaakfvevledaglpkgvinyvpgsgaev
    gdylvdhpktslitftgskdvgvrlyeraavvrpgqnhlkrvivemggkdtvvvdrdadl
    dlaaesilvsafgfsgqkcsagsravihkdvydevlektvalaknltvgdptnrdnymgp
    videkafekimsyieigkkegrlmtggegdsstgffiqptiiadldpeavimqeeifgpv
    vafskandfdhaleiannteygltgavitrnrahieqakrefhvgnlyfnrnctgaivgy
    hpfggfkmsgtdskaggpdylalhmqaktvsemya