PDB entry 3qaj

View 3qaj on RCSB PDB site
Description: X-ray crystal structure of glutamine synthetase from bacillus subtilis cocrystallized with ATP
Class: ligase
Keywords: amp-pcp, acp, glutamine synthetase, ligase
Deposited on 2011-01-11, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.229
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qaja1, d3qaja2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajb1, d3qajb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajc1, d3qajc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajd1, d3qajd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qaje1, d3qaje2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajf1, d3qajf2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajg1, d3qajg2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajh1, d3qajh2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qaji1, d3qaji2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajj1, d3qajj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajk1, d3qajk2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17460, glnA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qajl1, d3qajl2
  • Heterogens: PO4, GLU, MG, ADP, RGP, CIT, AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qajA (A:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajA (A:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri
    eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlg
    fsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfei
    eashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsg
    mhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgy
    eapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkle
    apapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakei
    ewdmfrtqvhpwereqymsqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qajB (B:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajB (B:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri
    eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlg
    fsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfei
    eashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsg
    mhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgy
    eapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkle
    apapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakei
    ewdmfrtqvhpwereqymsqy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qajC (C:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajC (C:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri
    eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlg
    fsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfei
    eashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsg
    mhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgy
    eapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkle
    apapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakei
    ewdmfrtqvhpwereqymsqy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qajD (D:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajD (D:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri
    eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlg
    fsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfei
    eashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsg
    mhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgy
    eapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkle
    apapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakei
    ewdmfrtqvhpwereqymsqy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qajE (E:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajE (E:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri
    eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlg
    fsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfei
    eashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsg
    mhcnlslfknvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgye
    apcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknklea
    papidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeie
    wdmfrtqvhpwereqymsqy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3qajF (F:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajF (F:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri
    eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlg
    fsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfei
    eashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsg
    mhcnlslfkngvnalqlsetakhiagivkhatsftavtnptvnsykrlvpgyeapcyvaw
    sanrspliripasrgistrvevrsvdpaanpylalsvllaaldgiknklepapidrniyv
    mskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewdmfrtqvhp
    wereqymsqy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3qajG (G:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajG (G:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssgfvsdmy
    lypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlgfsdfnl
    gpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfeieashhe
    vapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsgmhcnls
    lfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgyeapcyv
    awsanrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapapidr
    niyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewdmfrt
    qvhpwereqymsqy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3qajH (H:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajH (H:)
    tredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvrie
    esdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlgf
    sdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfeie
    ashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsgm
    hcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgye
    apcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknklea
    papidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeie
    wdmfrtqvhpwereqymsqy
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3qajI (I:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajI (I:)
    redieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvriee
    sdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlgfs
    dfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfeiea
    shhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsgmh
    cnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgyea
    pcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleap
    apidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiew
    dmfrtqvhpwereqymsqy
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3qajJ (J:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajJ (J:)
    redieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvriee
    sdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlgfs
    dfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfeiea
    shhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsgmh
    cnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgyep
    cyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapa
    pidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewd
    mfrtqvhpwereqymsqy
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3qajK (K:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajK (K:)
    redieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvriee
    sdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlgfs
    dfnlgpepefflfkldekgeptlelndkggyfdlaptdencrrdivleleemgfeieash
    hevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsgmhcn
    lslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgyeapc
    yvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapap
    idrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewdm
    frtqvhpwereqymsqy
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qajL (L:)
    makytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegf
    vrieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkeme
    dlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemg
    feieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvn
    gsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlv
    pgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgikn
    kleapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfiea
    keiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qajL (L:)
    redieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvriee
    sdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlgfs
    dfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfeiea
    shhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsgmh
    cnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgyea
    pcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknklapa
    pidrniyvmeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewdmf
    rtqvhpwereqymsqy