PDB entry 3qa3

View 3qa3 on RCSB PDB site
Description: Crystal Structure of A-domain in complex with antibody
Class: IMMUNE SYSTEM/ cell adhesion
Keywords: IMMUNE SYSTEM- cell adhesion complex
Deposited on 2011-01-10, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.196
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QA3 (0-219)
    Domains in SCOPe 2.07: d3qa3a1, d3qa3a2
  • Chain 'B':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QA3 (0-223)
  • Chain 'C':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QA3 (0-219)
    Domains in SCOPe 2.07: d3qa3c1, d3qa3c2
  • Chain 'D':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QA3 (0-223)
  • Chain 'E':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11215 (0-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3qa3e_
  • Chain 'F':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QA3 (0-219)
    Domains in SCOPe 2.07: d3qa3f1, d3qa3f2
  • Chain 'G':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11215 (0-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3qa3g_
  • Chain 'H':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QA3 (0-223)
  • Chain 'I':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11215 (0-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3qa3i_
  • Chain 'J':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QA3 (0-219)
    Domains in SCOPe 2.07: d3qa3j1, d3qa3j2
  • Chain 'K':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QA3 (0-223)
  • Chain 'L':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11215 (0-End)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3qa3l_
  • Heterogens: EDO, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qa3A (A:)
    diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qa3C (C:)
    diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qa3E (E:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekgfaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qa3E (E:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekgf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qa3F (F:)
    diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3qa3G (G:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekgfaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qa3G (G:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekgfa
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3qa3I (I:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekgfaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qa3I (I:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qa3J (J:)
    diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qa3L (L:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekgfaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qa3L (L:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekg