PDB entry 3q9v

View 3q9v on RCSB PDB site
Description: Crystal structure of rra c-terminal domain(123-221) from Deinococcus radiodurans
Class: DNA binding protein
Keywords: response regulator protein, DNA BINDING PROTEIN
Deposited on 2011-01-10, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_2418
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RRR8 (Start-132)
      • see remark 999 (127-132)
    Domains in SCOPe 2.07: d3q9va_
  • Chain 'B':
    Compound: DNA-binding response regulator
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_2418
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RRR8 (34-132)
      • see remark 999 (127-132)
    Domains in SCOPe 2.07: d3q9vb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q9vA (A:)
    mgsshhhhhhssgenlyfegshmasmtggqqmgrseslsmgdltldpqkrlvtykgeelr
    lspkefdilallirqpgrvysrqeigqeiwqgrlpegsnvvdvhmanlraklrdldgygl
    lrtvrgvgyalrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q9vA (A:)
    eslsmgdltldpqkrlvtykgeelrlspkefdilallirqpgrvysrqeigqeiwqgrlp
    egsnvvdvhmanlraklrdldgygllrtvrgvgyalrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q9vB (B:)
    mgsshhhhhhssgenlyfegshmasmtggqqmgrseslsmgdltldpqkrlvtykgeelr
    lspkefdilallirqpgrvysrqeigqeiwqgrlpegsnvvdvhmanlraklrdldgygl
    lrtvrgvgyalrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q9vB (B:)
    seslsmgdltldpqkrlvtykgeelrlspkefdilallirqpgrvysrqeigqeiwqgrl
    pegsnvvdvhmanlraklrdldgygllrtvrgvgyalrg