PDB entry 3q9s

View 3q9s on RCSB PDB site
Description: Crystal structure of rra(1-215) from Deinococcus Radiodurans
Class: DNA binding protein
Keywords: response regulator, DNA BINDING PROTEIN
Deposited on 2011-01-09, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_2418
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q9sa1, d3q9sa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q9sA (A:)
    mgsshhhhhhssgenlyfegshmasmtggqqmgrmneqrilvieddhdianvlrmdltda
    gyvvdhadsamnglikaredhpdlilldlglpdfdggdvvqrlrknsalpiivltardtv
    eekvrllglgaddylikpfhpdellarvkvqlrqrtseslsmgdltldpqkrlvtykgee
    lrlspkefdilallirqpgrvysrqeigqeiwqgrlpegsnvvdvhmanlraklrdldgy
    gllrtvrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q9sA (A:)
    eqrilvieddhdianvlrmdltdagyvvdhadsamnglikaredhpdlilldlglpdfdg
    gdvvqrlrknsalpiivltardtveekvrllglgaddylikpfhpdellarvkvqlrqrt
    seslsmgdltldpqkrlvtykgeelrlspkefdilallirqpgrvysrqeigqeiwqgrl
    pegsnvvdvhmanlraklrdldgygllrtv