PDB entry 3q9n

View 3q9n on RCSB PDB site
Description: In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Class: protein binding, de novo protein
Keywords: Structural Genomics, Israel Structural Proteomics Center, ISPC, Prb-binding designed ankyrin repeat, PROTEIN BINDING, DE NOVO PROTEIN
Deposited on 2011-01-09, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CoA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q9N (0-140)
    Domains in SCOPe 2.07: d3q9na_
  • Chain 'B':
    Compound: CoA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q9N (0-End)
    Domains in SCOPe 2.07: d3q9nb_
  • Chain 'C':
    Compound: consensus ankyrin repeat
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q9N (Start-157)
    Domains in SCOPe 2.07: d3q9nc_
  • Chain 'D':
    Compound: consensus ankyrin repeat
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q9N (0-157)
    Domains in SCOPe 2.07: d3q9nd_
  • Heterogens: CMS, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q9nA (A:)
    atrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpnyeev
    lgrkcypsvldipdkvevvdlfvnpakawrfvvyaikkgakvvwfqyntyyplaarqake
    agpiivanrcmmreherllge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q9nA (A:)
    atrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpnyeev
    lgrkcypsvldipdkvevvdlfvnpakawrfvvyaikkgakvvwfqyntyyplaarqagp
    iivanrcmmreherllge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q9nB (B:)
    atrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpnyeev
    lgrkcypsvldipdkvevvdlfvnpakawrfvvyaikkgakvvwfqyntyyplaarqake
    agpiivanrcmmreherllge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q9nB (B:)
    atrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpnyeev
    lgrkcypsvldipdkvevvdlfvnpakawrfvvyaikkgakvvwfqyntyyplaaagpii
    vanrcmmreherllg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q9nC (C:)
    afgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllk
    ngadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqlei
    vevllkhgadvnaqdalgltafdisinqgqedlaeilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q9nC (C:)
    fgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllkn
    gadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqleiv
    evllkhgadvnaqdalgltafdisinqgqedlaeilq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q9nD (D:)
    afgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllk
    ngadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqlei
    vevllkhgadvnaqdalgltafdisinqgqedlaeilq