PDB entry 3q8u

View 3q8u on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus nucleoside diphosphate kinase complexed with ADP
Class: transferase
Keywords: Ferridoxin fold, alpha-beta protein family, Nucleoside diphosphate kinases (NDKs) catalyze the transfer of a gamma phosphate from nucleoside triphosphates to nucleoside diphosphate, Nucleotide binding, Magnesium, Metal binding, Phosphorylation, TRANSFERASE
Deposited on 2011-01-07, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.184
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8ua_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8ub_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8uc_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8ud_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8ue_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8uf_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q8uA (A:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8uA (A:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q8uB (B:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8uB (B:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q8uC (C:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8uC (C:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q8uD (D:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8uD (D:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3q8uE (E:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8uE (E:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3q8uF (F:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8uF (F:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye