PDB entry 3q8n

View 3q8n on RCSB PDB site
Description: Crystal structure of 4-aminobutyrate transaminase from Mycobacterium smegmatis
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2011-01-06, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-aminobutyrate transaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: gabT, MSMEG_0581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8na_
  • Chain 'B':
    Compound: 4-aminobutyrate transaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: gabT, MSMEG_0581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8nb_
  • Chain 'C':
    Compound: 4-aminobutyrate transaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: gabT, MSMEG_0581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8nc_
  • Chain 'D':
    Compound: 4-aminobutyrate transaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: gabT, MSMEG_0581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q8nd_
  • Heterogens: SSN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q8nA (A:)
    gpgsmvtiaeiagrtltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaaggg
    vladadgnqlidfgsgiavttvgnsapavvdavtqqvaafthtcfmvtpyegyvkvaehl
    nrltpgdhekrtalfnsgaeavenavkiaraytrrqavvvfdhayhgrtnltmamtaknq
    pykhgfgpfanevyrvptsypfrdgetdgaaaaahaldlinkqvgadnvaavviepvhge
    ggfvvpapgflgalqkwctdngavfvadevqtgfartgalfacehenvvpdlivtakgia
    gglplsavtgraeimdgpqsgglggtyggnplacaaalavidtierenlvararaigetm
    lsrlgalaaadprigevrgrgamiavelvkpgttepdadltkrvaaaahaqglvvltcgt
    ygnvlrflpplsmpdhlldegldilaavfaevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8nA (A:)
    tltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaagggvladadgnqlidfg
    sgiavttvgnsapavvdavtqqvaafthtcfmvtpyegyvkvaehlnrltpgdhekrtal
    fnsgaeavenavkiaraytrrqavvvfdhayhgrtnltmamtaknqpykhgfgpfanevy
    rvptsypfrdgetdgaaaaahaldlinkqvgadnvaavviepvhgeggfvvpapgflgal
    qkwctdngavfvadevqtgfartgalfacehenvvpdlivtakgiagglplsavtgraei
    mdgpqsgglggtyggnplacaaalavidtierenlvararaigetmlsrlgalaaadpri
    gevrgrgamiavelvkpgttepdadltkrvaaaahaqglvvltcgtygnvlrflpplsmp
    dhlldegldilaavfaev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q8nB (B:)
    gpgsmvtiaeiagrtltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaaggg
    vladadgnqlidfgsgiavttvgnsapavvdavtqqvaafthtcfmvtpyegyvkvaehl
    nrltpgdhekrtalfnsgaeavenavkiaraytrrqavvvfdhayhgrtnltmamtaknq
    pykhgfgpfanevyrvptsypfrdgetdgaaaaahaldlinkqvgadnvaavviepvhge
    ggfvvpapgflgalqkwctdngavfvadevqtgfartgalfacehenvvpdlivtakgia
    gglplsavtgraeimdgpqsgglggtyggnplacaaalavidtierenlvararaigetm
    lsrlgalaaadprigevrgrgamiavelvkpgttepdadltkrvaaaahaqglvvltcgt
    ygnvlrflpplsmpdhlldegldilaavfaevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8nB (B:)
    tltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaagggvladadgnqlidfg
    sgiavttvgnsapavvdavtqqvaafthtcfmvtpyegyvkvaehlnrltpgdhekrtal
    fnsgaeavenavkiaraytrrqavvvfdhayhgrtnltmamtaknqpykhgfgpfanevy
    rvptsypfrdgetdgaaaaahaldlinkqvgadnvaavviepvhgeggfvvpapgflgal
    qkwctdngavfvadevqtgfartgalfacehenvvpdlivtakgiagglplsavtgraei
    mdgpqsgglggtyggnplacaaalavidtierenlvararaigetmlsrlgalaaadpri
    gevrgrgamiavelvkpgttepdadltkrvaaaahaqglvvltcgtygnvlrflpplsmp
    dhlldegldilaavfaev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q8nC (C:)
    gpgsmvtiaeiagrtltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaaggg
    vladadgnqlidfgsgiavttvgnsapavvdavtqqvaafthtcfmvtpyegyvkvaehl
    nrltpgdhekrtalfnsgaeavenavkiaraytrrqavvvfdhayhgrtnltmamtaknq
    pykhgfgpfanevyrvptsypfrdgetdgaaaaahaldlinkqvgadnvaavviepvhge
    ggfvvpapgflgalqkwctdngavfvadevqtgfartgalfacehenvvpdlivtakgia
    gglplsavtgraeimdgpqsgglggtyggnplacaaalavidtierenlvararaigetm
    lsrlgalaaadprigevrgrgamiavelvkpgttepdadltkrvaaaahaqglvvltcgt
    ygnvlrflpplsmpdhlldegldilaavfaevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8nC (C:)
    tltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaagggvladadgnqlidfg
    sgiavttvgnsapavvdavtqqvaafthtcfmvtpyegyvkvaehlnrltpgdhekrtal
    fnsgaeavenavkiaraytrrqavvvfdhayhgrtnltmamtaknqpykhgfgpfanevy
    rvptsypfrdgetdgaaaaahaldlinkqvgadnvaavviepvhgeggfvvpapgflgal
    qkwctdngavfvadevqtgfartgalfacehenvvpdlivtakgiagglplsavtgraei
    mdgpqsgglggtyggnplacaaalavidtierenlvararaigetmlsrlgalaaadpri
    gevrgrgamiavelvkpgttepdadltkrvaaaahaqglvvltcgtygnvlrflpplsmp
    dhlldegldilaavfaevk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q8nD (D:)
    gpgsmvtiaeiagrtltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaaggg
    vladadgnqlidfgsgiavttvgnsapavvdavtqqvaafthtcfmvtpyegyvkvaehl
    nrltpgdhekrtalfnsgaeavenavkiaraytrrqavvvfdhayhgrtnltmamtaknq
    pykhgfgpfanevyrvptsypfrdgetdgaaaaahaldlinkqvgadnvaavviepvhge
    ggfvvpapgflgalqkwctdngavfvadevqtgfartgalfacehenvvpdlivtakgia
    gglplsavtgraeimdgpqsgglggtyggnplacaaalavidtierenlvararaigetm
    lsrlgalaaadprigevrgrgamiavelvkpgttepdadltkrvaaaahaqglvvltcgt
    ygnvlrflpplsmpdhlldegldilaavfaevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q8nD (D:)
    tltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaagggvladadgnqlidfg
    sgiavttvgnsapavvdavtqqvaafthtcfmvtpyegyvkvaehlnrltpgdhekrtal
    fnsgaeavenavkiaraytrrqavvvfdhayhgrtnltmamtaknqpykhgfgpfanevy
    rvptsypfrdgetdgaaaaahaldlinkqvgadnvaavviepvhgeggfvvpapgflgal
    qkwctdngavfvadevqtgfartgalfacehenvvpdlivtakgiagglplsavtgraei
    mdgpqsgglggtyggnplacaaalavidtierenlvararaigetmlsrlgalaaadpri
    gevrgrgamiavelvkpgttepdadltkrvaaaahaqglvvltcgtygnvlrflpplsmp
    dhlldegldilaavfaevk