PDB entry 3q89

View 3q89 on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus nucleoside diphosphate kinase complexed with CDP
Class: transferase
Keywords: Ferridoxin fold, alpha-beta protein family, Nucleoside diphosphate kinases (NDKs) catalyze the transfer of a gamma phosphate from nucleoside triphosphates to nucleoside diphosphate, Nucleotide binding, Magnesium, Metal binding, Phosphorylation, TRANSFERASE
Deposited on 2011-01-06, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.254
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q89a_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q89b_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q89c_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q89d_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q89e_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q89f_
  • Chain 'G':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q89g_
  • Chain 'H':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q89h_
  • Heterogens: MG, CDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q89A (A:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q89A (A:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q89B (B:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q89B (B:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q89C (C:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q89C (C:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q89D (D:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q89D (D:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3q89E (E:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q89E (E:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3q89F (F:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q89F (F:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3q89G (G:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q89G (G:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3q89H (H:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q89H (H:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye