PDB entry 3q83

View 3q83 on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus nucleoside diphosphate kinase
Class: transferase
Keywords: Ferridoxin fold, alpha-beta protein family, Nucleoside diphosphate kinases (NDKs) catalyze the transfer of a gamma phosphate from nucleoside triphosphates to nucleoside diphosphate, Nucleotide binding, Metal binding, Phosphorylation, Kinase, Nucleotide metabolism, Transferase
Deposited on 2011-01-06, released 2011-07-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3q83a_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3q83b_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3q83c_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3q83d_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3q83e_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: ndk, SACOL1509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3q83f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q83A (A:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q83A (A:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q83B (B:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q83B (B:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q83C (C:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q83C (C:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q83D (D:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q83D (D:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3q83E (E:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q83E (E:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3q83F (F:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q83F (F:)
    mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
    lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
    esaereinlwfneneitsyasprdawlye