PDB entry 3q7j

View 3q7j on RCSB PDB site
Description: Engineered Thermoplasma Acidophilum F3 factor mimics human aminopeptidase N (APN) as a target for anticancer drug development
Class: hydrolase/hydrolase inhibitor
Keywords: Trf3, Inhibitor FBO, Aminopeptidase, Inhibitor binding, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-01-05, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.206
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tricorn protease-interacting factor F3
    Species: THERMOPLASMA ACIDOPHILUM [TaxId:273075]
    Gene: O93655, Ta0815, trf3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93655 (0-779)
      • engineered mutation (100)
      • engineered mutation (260)
    Domains in SCOPe 2.07: d3q7ja1, d3q7ja2, d3q7ja3, d3q7ja4
  • Chain 'B':
    Compound: Tricorn protease-interacting factor F3
    Species: THERMOPLASMA ACIDOPHILUM [TaxId:273075]
    Gene: O93655, Ta0815, trf3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93655 (0-779)
      • engineered mutation (100)
      • engineered mutation (260)
    Domains in SCOPe 2.07: d3q7jb1, d3q7jb2, d3q7jb3, d3q7jb4
  • Heterogens: ZN, FBO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q7jA (A:)
    mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv
    rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfqatdarrmfpcvdhpaykav
    faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkfryeyekyrdi
    dlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgagamenwgaitf
    reiymdiaensavtvkrnsatviaheiahqwfgdlvtmkwwndlwlnesfatfmsyktmd
    tlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeisygkgasilrm
    iedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeywiknpgypvik
    lkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadglikinads
    agfyrvlyddatfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffdde
    dhnvitaivgqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvd
    esyaeemsklfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafg
    klksntdlstvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgn
    rtasrtvemmipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q7jB (B:)
    mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv
    rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfqatdarrmfpcvdhpaykav
    faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkfryeyekyrdi
    dlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgagamenwgaitf
    reiymdiaensavtvkrnsatviaheiahqwfgdlvtmkwwndlwlnesfatfmsyktmd
    tlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeisygkgasilrm
    iedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeywiknpgypvik
    lkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadglikinads
    agfyrvlyddatfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffdde
    dhnvitaivgqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvd
    esyaeemsklfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafg
    klksntdlstvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgn
    rtasrtvemmipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk