PDB entry 3q7f

View 3q7f on RCSB PDB site
Description: Cryptococcus neoformans protein farnesyltransferase in complex with FPP and ethylenediamine inhibitor 1
Class: transferase/transferase inhibitor
Keywords: protein prenyltransferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-01-04, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyltransferase alpha subunit
    Species: Cryptococcus neoformans [TaxId:235443]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q7F
    Domains in SCOPe 2.07: d3q7fa_
  • Chain 'B':
    Compound: Farnesyltransferase beta subunit
    Species: Cryptococcus neoformans [TaxId:235443]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q7F
  • Heterogens: SUC, ZN, 3CX, FPP, ED2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q7fA (A:)
    mgsshhhhhhsqdlmvtstyipmsqrrswadvkpimqddgpnpvvpimyseeykdamdyf
    raiaakeekseralelteiivrmnpahytvwqyrfslltslnksledelrlmnefavqnl
    ksyqvwhhrlllldrispqdpvseieyihgsllpdpknyhtwaylhwlyshfstlgrise
    aqwgseldwcnemlrvdgrnnsawgwrwylrvsrpgaetssrslqdeliyilksihliph
    nvsawnylrgflkhfslplvpilpailpytasklnpdietveafgfpmpsdplpedtplp
    vplaleyladsfieqnrvddaakvfeklsseydqmragywefrrrecae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q7fA (A:)
    tyipmsqrrswadvkpimqddgpnpvvpimyseeykdamdyfraiaakeekseralelte
    iivrmnpahytvwqyrfslltslnksledelrlmnefavqnlksyqvwhhrlllldrisp
    qdpvseieyihgsllpdpknyhtwaylhwlyshfstlgriseaqwgseldwcnemlrvdg
    rnnsawgwrwylrvsrpgaetssrslqdeliyilksihliphnvsawnylrgflkhfslp
    lvpilpailpytafpmpspedtplpvplaleyladsfieqnrvddaakvfeklsseydqm
    ragywefrrreca
    

  • Chain 'B':
    No sequence available.