PDB entry 3q73

View 3q73 on RCSB PDB site
Description: Cryptococcus neoformans protein farnesyltransferase, apo enzyme
Class: transferase
Keywords: Protein prenyltransferase, TRANSFERASE
Deposited on 2011-01-04, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyltransferase, alpha subunit
    Species: Cryptococcus neoformans [TaxId:235443]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q73
    Domains in SCOPe 2.07: d3q73a_
  • Chain 'B':
    Compound: Farnesyltransferase, beta subunit
    Species: Cryptococcus neoformans [TaxId:235443]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q73
  • Heterogens: SUC, ZN, 3CX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q73A (A:)
    mgsshhhhhhsqdlmvtstyipmsqrrswadvkpimqddgpnpvvpimyseeykdamdyf
    raiaakeekseralelteiivrmnpahytvwqyrfslltslnksledelrlmnefavqnl
    ksyqvwhhrlllldrispqdpvseieyihgsllpdpknyhtwaylhwlyshfstlgrise
    aqwgseldwcnemlrvdgrnnsawgwrwylrvsrpgaetssrslqdeliyilksihliph
    nvsawnylrgflkhfslplvpilpailpytasklnpdietveafgfpmpsdplpedtplp
    vplaleyladsfieqnrvddaakvfeklsseydqmragywefrrrecae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q73A (A:)
    tyipmsqrrswadvkpimqddgpnpvvpimyseeykdamdyfraiaakeekseralelte
    iivrmnpahytvwqyrfslltslnksledelrlmnefavqnlksyqvwhhrlllldrisp
    qdpvseieyihgsllpdpknyhtwaylhwlyshfstlgriseaqwgseldwcnemlrvdg
    rnnsawgwrwylrvsrpgaetssrslqdeliyilksihliphnvsawnylrgflkhfslp
    lvpilpailpytafpmpsdplpedtplpvplaleyladsfieqnrvddaakvfeklssey
    dqmragywefrrreca
    

  • Chain 'B':
    No sequence available.