PDB entry 3q70

View 3q70 on RCSB PDB site
Description: Secreted aspartic protease in complex with ritonavir
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-01-04, released 2012-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.175
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Candidapepsin-2
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3q70a_
  • Heterogens: RIT, ZN, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q70A (A:)
    qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnvdcqvtysdqtadfck
    qkgtydpsgssasqdlntpfkigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
    qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdaatgqiifggvdnakys
    gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
    kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasefaaslqgddgqpydkcqllfdv
    ndanilgdnflrsayivydlddneislaqvkytsassisalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q70A (A:)
    qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnvdcqvtysdqtadfck
    qkgtydpsgssasqdlntpfkigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
    qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdaatgqiifggvdnakys
    gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
    kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasefaasldkcqllfdvndanilgd
    nflrsayivydlddneislaqvkytsassisalt