PDB entry 3q6y

View 3q6y on RCSB PDB site
Description: Endothiapepsin in complex with a pyrrolidine based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-01-04, released 2012-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.167
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q6ya_
  • Heterogens: DMS, S47, GOL, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q6yA (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6yA (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssdgqtiytpskstta
    kllsgatwssgdvytdtvsvggltvtgqavesakstidgllglafstlntvsptqqktff
    dnakasldspvftadlgyhapgtynfgfidttaytgsitytavstkqgfwewtstgyavg
    sgtfkstsidgiadtgttllylpatvvsaywaqvsgakssssvggyvfpcsatlpsftfg
    vgsarivipgdyidfgpistgssscfggiqssagiginifgdvalkaafvvfngattptl
    gfask